Chicken Whole Blood
ACROBiosystems Human LRRC15 2Vials
LRRC15 (Leucine-rich repeat-containing protein 15) is also known as LIB and hLib. LRRC15 is highly expressed in a variety of solid tumors. LRRC15 was expressed on stromal fibroblasts in many solid tumors (e.g. breast head and neck lung pancreatic) as well as directly on a subset of cancer cells of mesenchymal origin (e.g. sarcoma melanoma glioblastoma). LRRC15 expression was induced by TGFβ on activated fibroblasts (αSMA+) and on mesenchymal stem cells. These collective findings suggested LRRC15 as a novel CAF and mesenchymal marker with utility as a therapeutic target for the treatment of cancers with LRRC15-positive stromal desmoplasia or cancers of mesenchymal origin. ABBV-085 is a monomethyl auristatin E (MMAE)-containing antibody–drug conjugate (ADC) directed against LRRC15 and it demonstrated robust preclinical efficacy against LRRC15 stromal-positive/cancer-negative and LRRC15 cancer-positive models as a monotherapy or in combination with standard-of-care therapies.
ACROBiosystems Human APP 2Vials
Amyloid precursor protein (APP) is a type I integral membrane protein ubiquitously expressed in many tissues and concentrated in the synapses of neurons. It has three predominant splice variants: APP695 APP751 and APP770. The majority of APP is cleaved at the plasma membrane by the α-secretase in the non-amyloidogenic pathway. The amyloidogenic pathway starts with β-secretase cleavage by BACE1 on the N-terminal part of the Aβ domain releasing sAPPβ from a membrane-anchored fragment named βCTF or C99 which is subsequently cleaved by γ-secretase to release Aβ.
Kingfisher Biotech Inc Equine LIF Recombinant Protein
The Equine Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Equine Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Equine Leukemia Inhibitory Factor Specifications: (Molecular Weight: 21.3 kDa) (Amino Acid Sequence: SPLPITPDNA TCATRHPCHS NLMDQIRNQL VQLNSSANAL FILYYTAQGE PFPSNLDKLC RPDVTDFPPF HANGKEKARL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATSD TMRGLLSNVL CHLCSKYHVA NVDVAYGPDT SNKDVFQKKK LGCQLLGKYK QVIAVVAQAF QTGDLEAYSD PRS (193)) (Gene ID: 100629131). For research use only. Made in the USA
Kingfisher Biotech Inc Bee Melittin Recombinant Protein
The Bee Melittin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bee Melittin applications are for cell culture, ELISA standard, and Western Blot Control. Bee Melittin yeast-derived recombinant protein can be purchased in multiple sizes. Bee Melittin Specifications: (Molecular Weight: 2.8 kDa) (Amino Acid Sequence: GIGAVLKVLT TGLPALISWI KRKRQQ (26)) (Gene ID: 406130). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine Osteopontin Recombinant Protein
The Bovine Osteopontin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine Osteopontin applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Osteopontin yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Osteopontin Specifications: (Molecular Weight: 29.2 kDa) (Amino Acid Sequence: LPVKPTSSGS SEEKQLNNKY PDAVATWLKP DPSQKQTFLA PQNSVSSEET DDNKQNTLPS KSNESPEQTD DLDDDDDNSQ DVNSNDSDDA ETTDDPDHSD ESHHSDESDE VDFPTDIPTI AVFTPFIPTE SANDGRGDSV AYGLKSRSKK FRRSNVQSPD ATEEDFTSHI ESEEMHDAPK KTSQLTDHSK ETNSSELSKE LTPKAKDKNK HSNLIESQEN SKLSQEFHSL EDKLDLDHKS EEDKHLKIRI SHELDSASSE VN (262)) (Gene ID: 281499). For research use only. Made in the USA
Kingfisher Biotech Inc Human CXCL1 Recombinant Protein
The Human CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Human CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Human CXCL1 Specifications: (Molecular Weight: 10.2 kDa) (Amino Acid Sequence: ATELRCQCLQ TLQGIHPKNI QSVNVKSPGP HCAQTEVIAT LKNGRKACLN PASPIVKKII EKMLNSDKSN (70)) (Gene ID: 2919). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine Prolactin Receptor Recombinant Protein
The Bovine Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Prolactin Receptor Specifications: (Molecular Weight: 24.8 kDa) (Amino Acid Sequence: QSPPEKPKLV KCRSPGKETF TCWWEPGADG GLPTNYTLTY HKEGETLIHE CPDYKTGGPN SCYFSKKHTS IWKMYVITVN AINQMGISSS DPLYVHVTYI VEPEPPANLT LELKHPEDRK PYLWIKWSPP TMTDVKSGWF IIQYEIRLKP EKATDWETHF TLKQTQLKIF NLYPGQKYLV QIRCKPDHGY WSEWSPESSI QIPNDFPVKD TSM (213)) (Gene ID: 281422). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-34 Recombinant Protein
The Chicken IL-34 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-34 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken IL-34 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-34 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: ECELARLLQD KLRYEMRLQY MKHNFPIDYT LRVQHEEVLR TANVTRLRDG KVSEASLRYL WFHACSQAVL HILEVLPEKH PSRGYTQELS QLLDALGVEY SGYRQSDVDA VVADLVKQLH SGDSRQKAVR PKALLDNCLK VLRMLFGAHC RWDSA (155)) (Gene ID: 100858424). For research use only. Made in the USA
Kingfisher Biotech Inc Hamster IL-13 Recombinant Protein
The Hamster IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: APGPVPRSMS PPVALRELIE ELSNITQDQR APLCNGSMVW SVDLTNGGFC AALDSLTNIS SCRPIYKTQR ILNGLCVRRA SAGVSSLPDT KVEVVQFIVT LLSYSRQLYR HGKFP (115)) (Gene ID: 101843388). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-13 Recombinant Protein
The Feline IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-13 Specifications: (Molecular Weight: 12.7 kDa) (Amino Acid Sequence: SPGPHSRREL KELIEELVNI TQNQVSLCNG SMVWSVNLTT GMQYCAALES LINVSDCTAI QRTQRMLKAL CTQKPSAGQT ASERSRDTKI EVIQLVKNLL NHLRRNFRHG NFK (113)) (Gene ID: 101084678). For research use only. Made in the USA
Kingfisher Biotech Inc Rat Prolactin Receptor Recombinant Protein
The Rat Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Rat Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Rat Prolactin Receptor Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: QSPPGKPEIH KCRSPDKETF TCWWNPGTDG GLPTNYSLTY SKEGEKTTYE CPDYKTSGPN SCFFSKQYTS IWKIYIITVN ATNQMGSSSS DPLYVDVTYI VEPEPPRNLT LEVKQLKDKK TYLWVKWSPP TITDVKTGWF TMEYEIRLKP EEAEEWEIHF TGHQTQFKVF DLYPGQKYLV QTRCKPDHGY WSRWSQESSV EMPNDFTLKD (210)) (Gene ID: 24684). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IFN alpha 1 Biotinylated Recombinant Protein
The Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 Biotinylated applications are for cell culture. Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Biotinylated Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA
Kingfisher Biotech Inc Jamaican Fruit-eating Bat LIF Recombinant Protein
The Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat Leukemia Inhibitory Factor Specifications: (Molecular Weight: 19.9 kDa) (Amino Acid Sequence: TPLPITPVNA TCVTRHPCHS NVMNQIRNQL VQLNSSANAL FILYYTVQGE PFSNNLEKLC SPNVTDFPPF HANGTEKARL VELYRIAAYL GASLGNITRD QKTLSPHAIS LHSKLNATLD VMRGLLSNVL CRLCSKYHVA HVEVAYGPDT SGKDMFQKKK LGCQLLGKYK QVIAVLAQAF (180)) (Gene ID: 119055186). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL13 Recombinant Protein
The Human CCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL13 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDALNVPST CCFTFSSKKI SLQRLKSYVI TTSRCPQKAV IFRTKLGKEI CADPKEKWVQ NYMKHLGRKA HTLKT (75)) (Gene ID: 6357). For research use only. Made in the USA
Kingfisher Biotech Inc Hamster CCL28 Recombinant Protein
The Hamster CCL28 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CCL28 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CCL28 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CCL28 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: ILPIASSCCT EVSHHISRRL LERVNSCSIQ RADGDCDLAA VILHVKRRRI CVSPHNQTLK HWMRVSEEKK NGKENPCHKK LHSRRDRKSH IQRNHGKQGH NAPR (104)) (Gene ID: 101843973). For research use only. Made in the USA